PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.010G053200.1
Common NamePHAVU_010G053200g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 316aa    MW: 36042.9 Da    PI: 5.7811
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.010G053200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.81.2e-131358146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                        +g+W +eEde l++ vk++G+++W++I ++  + Rt+k+c++rw +
  Phvul.010G053200.1 13 KGPWKAEEDEVLLNHVKKYGPRDWSSIRSKGLLQRTGKSCRLRWVN 58
                        79*************************8887799**********87 PP

2Myb_DNA-binding39.41.4e-1269109345
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         +++ eE+   +++ +q+G++ W++Ia+++  gRt++++k++w 
  Phvul.010G053200.1  69 KFSLEEERVVIELQAQFGNR-WAKIASYLA-GRTDNDVKNFWS 109
                         799*****************.*********.***********6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.3E-21661IPR009057Homeodomain-like
PROSITE profilePS5129419.88864IPR017930Myb domain
SuperFamilySSF466891.41E-2711108IPR009057Homeodomain-like
SMARTSM007176.9E-111262IPR001005SANT/Myb domain
CDDcd001674.46E-111560No hitNo description
PfamPF139215.8E-131675No hitNo description
Gene3DG3DSA:1.10.10.607.4E-1762114IPR009057Homeodomain-like
PROSITE profilePS5129417.78365116IPR017930Myb domain
SMARTSM007177.4E-1266114IPR001005SANT/Myb domain
CDDcd001677.50E-1069108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MHGKKEQEEY IRKGPWKAEE DEVLLNHVKK YGPRDWSSIR SKGLLQRTGK SCRLRWVNKL  60
RPNLKNGCKF SLEEERVVIE LQAQFGNRWA KIASYLAGRT DNDVKNFWSS RRKRLARILH  120
TSATTAKSQK NKTKVPTLLD VPTLEAPKFS SSSEGESSSK PQSYSLPLIE NSEVIKMVSL  180
PELIKCELPC SDPIHIEQEF TLFESYKISE QNQQIPFPQM PELQNDLTFP VGSQDVLARI  240
DEPCFIEDFC ALDDVSEFGI GLQHPIGFPF FEPPGSCRIE TRDTIDKFKS SDSFFDDFPM  300
DMFDLMDPPA SPSNL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-271111425126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150420.0AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007134506.10.0hypothetical protein PHAVU_010G053200g
TrEMBLV7AMK30.0V7AMK3_PHAVU; Uncharacterized protein
STRINGGLYMA07G14480.11e-176(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36933164
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.11e-73MYB family protein